SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025520 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025520
Domain Number 1 Region: 65-368,535-570
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.35e-48
Family FAD-linked reductases, N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025520   Gene: ENSMMUG00000019416   Transcript: ENSMMUT00000027279
Sequence length 610
Comment pep:known chromosome:MMUL_1:13:85905700:85917843:-1 gene:ENSMMUG00000019416 transcript:ENSMMUT00000027279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLPLVLFLTVLLLAVVCKVYLGLFSGKSPNPFSEDVKRPPAPLVTDKEARKKVLKQAFS
ASRVPEKLDVVVIGSGFGGLAAAAILAKAGKRVLVLEQHTKAGGACHTFGENGLEFDTGI
HYIGRMEEGSIGRFILDQITEGQLDWVPMSSPFDIMVLEGPNGRKEYPMYSGEKAYIQGL
KEKFPQEEAIIDKYIKLVKVVSNGVAHAILLKFLPLPVIQLLDRCGLLTRFSPFLHASTQ
SLAEVLQQLGASSELQAVLSYIFPTYGVTPRHSAFSMHALLVNHYLKGAFYPRGGSSEIA
FHTIPVIQRAGGAVLTRATVQSVLLDSAGKACGVSVKKGHELVNIYCPVVVSNAGLFNTY
EHLLPGNARCLPGVKQQLGMVRPGLGMMSVFICLRGTKEDLHLPSTNYYVYHDTDMDQAM
ERYVSMPREKAAEHIPLMFIAFPSAKDPTWEDRFPGRSSMIMLIPSAYEWFEEWQAELKG
KRGSDYETFKNSFVEASMSVVMKLFPQLEGKVESVTAGSPLTNQFYLAAPRGACYGADHD
LGRLHPRVMASLRAQSPIPNLYLTGQDIFTCGLVGALQGALLCSSAILKRNLYSDLKDLG
SRIQAQKKKN
Download sequence
Identical sequences F6R9J4
ENSMMUP00000025520 NP_001244492.1.72884 9544.ENSMMUP00000025520 ENSMMUP00000025520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]