SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025602 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025602
Domain Number 1 Region: 495-527,567-632
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025602   Gene: ENSMMUG00000019481   Transcript: ENSMMUT00000027373
Sequence length 657
Comment pep:known_by_projection chromosome:MMUL_1:8:93880473:94021736:1 gene:ENSMMUG00000019481 transcript:ENSMMUT00000027373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAKKKKKSMLWGKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERIVP
QNIQNLTTPSNTSVLGLSDFEMQRIHVAVAVSFLGGVIQVAMFVLQLGSATFVVTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTLSI
KNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNIIQKENACNQPLDDI
SKSCHNHLKLHSSISVSPTEEVSQSCPNEKCSLILDCSGFTFFDYSGVSMLVEVYMDCKG
RSVDVLLAHCTASLIKGMTYYGNLDSEKPIFFESVSAAISHIHSSKNLSKLSDHSEV
Download sequence
Identical sequences ENSMMUP00000025602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]