SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025647 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025647
Domain Number 1 Region: 230-361
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-30
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 439-572
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-29
Family Cadherin 0.00076
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-24
Family Cadherin 0.0057
Further Details:      
 
Domain Number 4 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 1.05e-19
Family Cadherin 0.0042
Further Details:      
 
Domain Number 5 Region: 555-664
Classification Level Classification E-value
Superfamily Cadherin-like 7.07e-18
Family Cadherin 0.0027
Further Details:      
 
Domain Number 6 Region: 32-96
Classification Level Classification E-value
Superfamily Cadherin-like 0.00007
Family Cadherin 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025647   Gene: ENSMMUG00000019524   Transcript: ENSMMUT00000027424
Sequence length 776
Comment pep:known_by_projection chromosome:MMUL_1:6:137582766:137628414:1 gene:ENSMMUG00000019524 transcript:ENSMMUT00000027424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIGWMHSRRQRQVLVFFVLLSLSGAGAELGSYSVVEETERGSFVANLEKDLGLGLTEMS
TRRARIISQGNKQHLQLKVQTGDLLINEKLDREELCGPTEPCILHFQVLMEKPLEIFQAE
LRVIDINDHSPIFTEKEIILKIPENSPLGTEFPLYHALDSDVGSNNVQNYKISPNSHFGI
LTKERTDGRKYPELVLDKELDREEEPQLRLTLTALDGGSPPRSGTAQVHIEVVDINDNAP
EFEQPIYKVRIPENSSLGSLVATVSARDLDSGANGKISYSLFQPSEDISKTLEVNAMTGE
IRLRKQVDFEGVTSYEVHIKATDGGGLSGKCTLLLQVVDVNDNPPQVTMSALTSPIPENS
PEIVVAVFSVSDPDSGNNGKTISSIQEDLPFLLKPSVKNFYTLVTERALDREARAEYNIT
LTVTDMGTPRLKTEHNITVQISDVNDNAPAFTQTFYTLFVRENNSPALHIGSVSATDRDS
GTNAQVTYSLLPPEDPHLPLSSLVSINADNGHLFALRSLDYEALQEFEFRVGATDRGSPA
LSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAQPGYLVTKVVAVDGDSGQNA
WLSYQLLKVTEPGLFGVWAHNGEVRTARPLSERDGAKHRLVVLVKDNGEPPRSATTTLHV
FLVDGFSQPYLPLPEAAPAQAQADSLTIYLVVALASVSSLFLLSVLLFVAVRLCRRSRAA
SVGRCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLTGGSGTNEFKFLKPIIPNLLP
Download sequence
Identical sequences ENSMMUP00000025647 ENSMMUP00000025647 9544.ENSMMUP00000025647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]