SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025738 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025738
Domain Number 1 Region: 214-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000336
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 178-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000104
Family EGF-type module 0.042
Further Details:      
 
Domain Number 3 Region: 259-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000743
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025738
Domain Number - Region: 372-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 330-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00189
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 296-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025738   Gene: ENSMMUG00000019596   Transcript: ENSMMUT00000027519
Sequence length 433
Comment pep:known chromosome:MMUL_1:4:61815389:61930422:-1 gene:ENSMMUG00000019596 transcript:ENSMMUT00000027519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDKSIIILSLMVFHSSFINGKTCRRELVEEWHPQPSSHVVNWTLTENICLDYYRDCWFL
GVNTKIDTSGNQVVPQICPLQIQLGDILVISSEPSLQFPEINLMNVSETSFIGCVQNTTT
EDQLLFGCRLKGMHTVNSKWLSVGTHYFITVMASGPSPCPLGLRLNVTVKQQFCQESLSS
EFCSGHGKCLSEAWSKTYSCHCQPPFSGKYCQELDACSFKPCKNDGSCINKRGNWDEQGY
ECVCHPPFTGKNCSEIIGQCQPHVCFHGNCSNITSNSFICECDEQFSGPFCEVSTKPCVS
LLCWKRGICPNSSSAYTYECPKGPSSQNGETDVSECSLILCENGTDGIKISNDVMCICSP
IFTDLLCKSFQTSCESFPLKNNATFKKCEKDYHCSCMSGFTGKNLEKVIDHCKLLSINCL
NEEWCFNIIGRFK
Download sequence
Identical sequences ENSMMUP00000025738 9544.ENSMMUP00000025738 ENSMMUP00000025738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]