SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025789 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025789
Domain Number 1 Region: 86-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.32e-44
Family Glutathione S-transferase (GST), C-terminal domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.73e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025789   Gene: ENSMMUG00000019630   Transcript: ENSMMUT00000027574
Sequence length 218
Comment pep:known chromosome:MMUL_1:1:112730226:112770105:1 gene:ENSMMUG00000019630 transcript:ENSMMUT00000027574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMTLGYWNIRGLAHAIRLLLEYTDSNYEEKKYRMGHAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGETEEEKILVDILENQLMDSRMEMVRLCFDPNF
EKLKPKYLEELPEKLKLYSQFLGKRPWFTGDKITFVDFLAYDVLDMRRIVEPGCLDAFPN
LKDFISRFEGLKKISAYMKSSRFHRGLLFGTTATWNST
Download sequence
Identical sequences ENSMMUP00000025789 ENSMMUP00000025789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]