SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025790 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025790
Domain Number 1 Region: 86-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.73e-46
Family Glutathione S-transferase (GST), C-terminal domain 0.000000223
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.88e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025790   Gene: ENSMMUG00000019630   Transcript: ENSMMUT00000027575
Sequence length 218
Comment pep:known chromosome:MMUL_1:1:112730224:112736453:1 gene:ENSMMUG00000019630 transcript:ENSMMUT00000027575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMTLGYWNIRGLAHSIRLLLEYTGSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGETEKEKIREDILENQLMDNRMQLARLCYDPDF
EKLKPEYLEGLPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Download sequence
Identical sequences F7AUZ4 Q9BEB0 Q9TSM4
ENSMMUP00000007678 ENSMMUP00000025788 ENSMMUP00000025790 NP_001248580.1.72884 NP_001274584.1.63531 XP_011735505.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]