SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025891 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025891
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.13e-20
Family THAP domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025891   Gene: ENSMMUG00000019702   Transcript: ENSMMUT00000027679
Sequence length 274
Comment pep:known chromosome:MMUL_1:19:42525082:42545211:-1 gene:ENSMMUG00000019702 transcript:ENSMMUT00000027679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKYCRAPNCSNTAGSLGADNRPVSFYKFPLKDGPRLQAWLRHMGREHWVPSCHQHLCSE
HFTPSCFQWRWGVRYLRPDAVPSIFSQAPPAKSQQRTRRTQKPVSPPPPLQEKTPLPQGP
AIPVSDPVRLVVLDPTSGSPETAATMLLTPLAPAATPEGSQPEVPAQQAQTGLGSVLGAL
QRRVQRLQRCQEQHQAQLQALERLAQQLHGESLLARACRGLQRLTTAQTLGPEESQTFTI
ICGGPDIAVVLAQGPAPATVDAKPELLDTRTPSA
Download sequence
Identical sequences A0A2K6BCA4 F7CAH3
ENSMMUP00000025891 ENSMMUP00000031649 9544.ENSMMUP00000031649 ENSMMUP00000025891 NP_001181130.1.72884 XP_011763406.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]