SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025947 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025947
Domain Number 1 Region: 341-469
Classification Level Classification E-value
Superfamily TIMP-like 5.34e-29
Family Tissue inhibitor of metalloproteinases, TIMP 0.045
Further Details:      
 
Domain Number 2 Region: 271-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 155-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000137
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025947   Gene: ENSMMUG00000019737   Transcript: ENSMMUT00000027738
Sequence length 485
Comment pep:known_by_projection chromosome:MMUL_1:19:54966856:54975349:-1 gene:ENSMMUG00000019737 transcript:ENSMMUT00000027738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTFALLLLLGQATADPCYDPQGRPQFCLPPVTQLAAVAASCPQACALSPGNHLGETCN
GSLTLALGGSFLLTSVSLRFCTPGPPALILSAAWASGGPWRLLWHRPAWPGALGGPERVT
FHSTPDPKATVVASHLRVEFGGQAGLAAAGLRGRCQCHGHAARCAARARPPRCHCRHHTT
GPGCESCRPSHRDWPWRPATPQHPHPCLRESCALYSPYLCLPATGSFGLGSGPLGLREEG
LGAWTPGRHCGIRRGIWGPDTPCSSSAHVACQCHPIGATGGTCNQTSGQCTCKLGVTGLT
CNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCNMSDTRVYMSLRRYC
QQDYVLRAQVLASEAAGPAWRRLAVRVQAVYKQRAQFVRRGDQDAWVPRADLACGCLRLQ
PGTDYLLLGSVVGGPDPTRLILDRHGLALPWRPRWARPLRRLQQEERAGGCRGVRAPTSS
PRPEH
Download sequence
Identical sequences ENSMMUP00000025947 9544.ENSMMUP00000025947 ENSMMUP00000025947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]