SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025951 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025951
Domain Number 1 Region: 38-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00065
Further Details:      
 
Domain Number 2 Region: 150-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-39
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 3 Region: 351-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-35
Family Laminin G-like module 0.0053
Further Details:      
 
Domain Number 4 Region: 723-738,774-936
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.29e-35
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 5 Region: 967-1171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-29
Family Laminin G-like module 0.0069
Further Details:      
 
Domain Number 6 Region: 577-634
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000131
Family Fibrinogen C-terminal domain-like 0.0053
Further Details:      
 
Domain Number 7 Region: 548-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000179
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025951   Gene: ENSMMUG00000019739   Transcript: ENSMMUT00000027742
Sequence length 1306
Comment pep:known chromosome:MMUL_1:13:130297532:131166979:1 gene:ENSMMUG00000019739 transcript:ENSMMUT00000027742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVPRLTSVLTLLFSGLWHLGLTATNYNCDDPLASLLSPMAFSSSSDLTGTHSPAQLNW
RVGTGGWSPADSNAQQWLQMDLGNRVEITAVATQGRYGSSDWVTSYSLMFSDTGRNWKQY
KQEDSIWTFAGNMNADSVVHHKLLHSVRARFVRFVPLEWNPSGKIGMRVEVYGCSYKSDV
ADFDGRSSLLYRFNQKLMSTLKDVISLKFKSMQGDGVLFHGEGQRGDHITLELQKGRLSL
HLNLDDSKARLSSSLPSATLGSLLDDQHWHSVLIERVGKQVNFTVDKHTQHFRTKGETDA
LDIDYELSFGGIPVPGKPGTFLKKNFHGCIENLYYNGVNIIDLAKRRKHQIYTGNVTFSC
SEPQIVPITFINSSGSYLLLPGTPQIDGLSVSFQFRTWNKDGLLLSTELSEGSGTLLLSL
ESGILRLVIQKMTERVAEILTGSNLNDGLWHSVSINARRNRITLTLDNEAAPPAPDSTWV
QIYSGNSYYFGGCPDNLTDSQCLNPIKAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLH
IDLCSIKDRCLPNYCEHGGSCSQSWTTFYCNCSDTSYTGATCHNSIYEQSCEVYRHQGNT
AGFFYIDSDGSGPLGPLQVYCNITEDKIWTSVQHNNTELTRVRGANAEKPYAMALDYGGS
MEQLEAVIDGSEHCEQEVAYHCRRSRLLNTPDGTPFTWWIGRSNERHPYWGGSPPGVQQC
ECGLDESCLDIQHFCNCDADKDEWTNDTGFLSFKDHLPVTQIVITDTDRSNSEAAWRIGP
LRCYGDRRFWNAVSFYTEASYLHFPTFHAEFSADISFFFKTTALSGVFLENLGIKDFIRL
EISSPSEITFAIDVGNGPVELVVQSPSLLNDNQWHYVRAERNLKETSLQVDNLPRSTRET
SEEGHFRLQLNSQLFVGGTSSRQKGFLGCIRSLHLNGQKLDLEERAKVTSGVRPGCPGHC
SSYGSICHNGGKCVEKHNGYLCDCTNSPYEGPFCKKEVSAVFEAGTSVTYMFQEPYPVTK
NISLSSSAIYTDSAPSKENIAFSFVTAQTPSLLLFVNSSSQDFLAVLLCKNGDLQVRYHL
NKEETHVFTIDADNFANRRMHHLKINREGRELTIQMDHQLRLSYNFSPEVEFRVIRSLTL
GKVTENLGLDSEVAKANALGFAGCMSSVQYNHIAPLKAALRHATAAPVTVHGTLTESSCD
FMVDSDVDAVTTVHSSSDPFGKTDEREPLTNAVRSDSAVIGGVIAVVIFIIFCIIGIMTR
FLYQHKQSHRTNQMKEKEYPENLDSSFRNDIDLQNTVSECKREYFI
Download sequence
Identical sequences 9544.ENSMMUP00000025951 ENSMMUP00000025951 ENSMMUP00000025951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]