SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026025 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026025
Domain Number 1 Region: 148-206
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000136
Family VWC domain 0.0078
Further Details:      
 
Domain Number 2 Region: 1-45
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.0000388
Family Myeloperoxidase-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026025   Gene: ENSMMUG00000019792   Transcript: ENSMMUT00000027818
Sequence length 213
Comment pep:known chromosome:MMUL_1:13:1560767:1571019:-1 gene:ENSMMUG00000019792 transcript:ENSMMUT00000027818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLTQIKQTSLARILCDNADNITRVQSDVFRVAEPSWLCSCDEIPRWTSGCGNCRTRGQFN
AFSYHFRGRRSLEFSYQEDQPTKKTRPQKTPSVGRHGEHLSNSTSAFSTRSDTPGTNDFR
EFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTC
FVEACPPATCAVPTNIPGACCPVCLQRRAEEKP
Download sequence
Identical sequences ENSMMUP00000026025 ENSMMUP00000026025 9544.ENSMMUP00000026025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]