SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026043 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026043
Domain Number 1 Region: 1-71
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.59e-28
Family Actin/HSP70 0.000031
Further Details:      
 
Domain Number 2 Region: 65-105
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.000000000000868
Family Actin/HSP70 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026043   Gene: ENSMMUG00000019811   Transcript: ENSMMUT00000027838
Sequence length 107
Comment pep:novel chromosome:MMUL_1:1:38334447:38336162:1 gene:ENSMMUG00000019811 transcript:ENSMMUT00000027838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKIWHRTFYNELCVAPEEHPMLLTEARLNPKANREKMTQIMFETFNTPAMYVAIQAVLS
LYTSGRTTGIVMDSGDRVTHTVPIYEGYALPHTILCLDLAGRDLTTS
Download sequence
Identical sequences ENSMMUP00000026043 9544.ENSMMUP00000026043 ENSMMUP00000026043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]