SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026056 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026056
Domain Number 1 Region: 86-211
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.71e-67
Family RUNT domain 0.000000327
Further Details:      
 
Domain Number 2 Region: 16-70
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00000602
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026056   Gene: ENSMMUG00000019819   Transcript: ENSMMUT00000027851
Sequence length 503
Comment pep:known_by_projection chromosome:MMUL_1:4:45311812:45434354:1 gene:ENSMMUG00000019819 transcript:ENSMMUT00000027851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQQQEAAAAAA
AAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPV
AFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFT
LTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMR
VGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHST
TPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPS
ISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQ
TSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQNDGVDADG
SHSSSPTVLNSSGRMDESVWRPY
Download sequence
Identical sequences ENSMMUP00000026056 ENSMMUP00000026057 9544.ENSMMUP00000026056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]