SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026100 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026100
Domain Number 1 Region: 147-278
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-29
Family Cadherin 0.00026
Further Details:      
 
Domain Number 2 Region: 372-492
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-25
Family Cadherin 0.0053
Further Details:      
 
Domain Number 3 Region: 482-589
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-16
Family Cadherin 0.0036
Further Details:      
 
Domain Number 4 Region: 76-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000171
Family Cadherin 0.0038
Further Details:      
 
Domain Number 5 Region: 261-376
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000581
Family Cadherin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026100   Gene: ENSMMUG00000019846   Transcript: ENSMMUT00000027897
Sequence length 789
Comment pep:known_by_projection chromosome:MMUL_1:6:26920362:27034889:-1 gene:ENSMMUG00000019846 transcript:ENSMMUT00000027897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTYHCIPLLIWTYMFHTVDTILLQEKPNSYLSSKKIVGLTKDDGKMLRRTKRGWMWNQF
FLLEEYTGTDTQYVGKLHTDQDKGDGNLKYILTGDGAGSLFVIDENTGDIHAAKKLDREE
KSLYILRAKAIDRKTGRQVEPESEFIIKIHDINDNEPKFTKDLYTASVPEMSGVGTSVIQ
VTATDADDANYGNSAKVVYSILQGQPYFSVDPESGIIKTALPDMSRENREQYQVVIQAKD
MGGQMGGLSGTTTVNITLTDVNNNPPRFPQSTYQFNSPEYLFVFLHRGKNKHAAIIISCT
FQNIFIVNVGEHSESLHLIIQLNKSKSMSTIEKNLDFENQMLYTLRVDASNTHPDPRFLH
LGPFKDTAVVKISVEDIDEPPVFSKVSYLIEVDEDVKEGSIIGQVTAYDPDARNNLIKYS
VDRHTDMDRIFGIHSENGSIFTLKALDRESSPWHNITVTATEINNPKQSSHIPVFIRILD
INDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFYFEPVPEFTLNPNFTIV
DNKDNTAGIMTRKDGYSRNKMSTYLLPILIFDNDYPIQSSTGTLTIRVCACDNQGNMQSC
TAEALILSAGLSTGALVAILLCVLILLILVVLFAALKRQRKKEPLIISKDDVRDNIVTYN
DEGGGEEDTQAFDIGTLRNPEAREDSKLRRDVMPETIFQIRRTVPLWENIDVQDFIHRRL
KENDADPSAPPYDSLATYAYEGNDSIADSLSSLESLTADCNQDYDYLSDWGPRFKKLADM
YGGDDSDRD
Download sequence
Identical sequences ENSMMUP00000026100 ENSMMUP00000026100 9544.ENSMMUP00000026100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]