SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026132 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026132
Domain Number 1 Region: 102-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 67-113,507-542
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000113
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026132   Gene: ENSMMUG00000019878   Transcript: ENSMMUT00000027932
Sequence length 561
Comment pep:known_by_projection chromosome:MMUL_1:6:39098742:39182953:-1 gene:ENSMMUG00000019878 transcript:ENSMMUT00000027932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSACWSFAAAICILEISVLTAEYTPSYDPQPTESRGSASHIDCRMSPWSEWSQCDPCLRQ
MFRSRSIEVFGQFNGKSCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCGTGRCIKRRLLCN
GDNDCGDFSDEDDCEGDPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGL
CNRDRDGNTLTYYRRPWNVASLIYETKGEKNLRTEHYEEQIEAFKSIVQEKTSNFNADIS
LKFIPTEANKVKTEKSSEKQASSNSLRGQGSFRFSYSKNETYQLFLSYSSKKEKMFLHVK
GEIHLGRFMMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYEL
IYVLDKASMNRKGVELKDVKRCLGYHLDVSLDFSKISAGAKADKDDCVKRGEGRAVNITS
DHLIDDVISLIRGGTRQYAFELKEKLLRGTMIDVTDFVNWASSINDAPVLISQKLSPIYN
LVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHSCQNGGTAILMDGKCLCTCPFKFEGIA
CEISKQKVSEGLPALDFPREK
Download sequence
Identical sequences F7GRY2
9544.ENSMMUP00000026132 ENSMMUP00000026132 XP_001084671.1.72884 ENSMMUP00000026132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]