SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026157 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026157
Domain Number 1 Region: 206-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 2 Region: 252-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 3 Region: 73-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000324
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 118-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 26-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000515
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026157
Domain Number - Region: 629-715
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00199
Family Biotin holoenzyme synthetase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026157   Gene: ENSMMUG00000001220   Transcript: ENSMMUT00000027959
Sequence length 722
Comment pep:known_by_projection chromosome:MMUL_1:19:6787309:6826299:1 gene:ENSMMUG00000001220 transcript:ENSMMUT00000027959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFTGCCVMHSWERHTGPTLKPTTKDNKCRDSTMCPSHATCTSTVDSYYCACKQGFRSSNG
QNHFKDPGVECKDVDECSESQPCGPNSVCKNLSGRYECSCLHGFSSPTGNNWKPGKPGNF
SCTDINECLTGRVCPEHSDCVNSMGSYNCNCQVGFISRNSICKNIYHMTSPRRRGPWLGC
HFLVKHDSVFCKGKYDFVGSLTNLTPHPFYTDIDECTEMCLINSTCTNTPGSYFCTCHPG
FAPSNGQLNFTDQKVECRDIDECRQDPSTCGPNSICTNALGSYSCGCIAGFRPDPESSQK
DGNFSCQRVPFKCKEDVIPDNEQVQQCQDRTTVKPEYATVSFCAQMNNIFSVLDNVCENK
TTVVSLKNTTESFVPVLKQISTWTKFTKEETSSLATVFLESVETLTLAAFLKPSANVTQT
VRTDYLDIESKVINKECSEENVNLSLAAKGDKMKIRCSTIEESESTGTTGVAFVSFVGVE
SVLNERFFQDHQAPLTTSKIKLKMNSRVVGGIMTGEKKDGFSDPVIYTLENIQPKQEFER
PICVSWSTDVKGGRWTSFGCVILEASEIHTVCSCNRMANLAVIMASGELTTGCAIIAGFL
HYLFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKMLHICAFGYGLPVLVVVISASVQ
SQGYGMHNRCWLNTETGFIWSFLGPVCTVIAINSILLTWTLWILRQRLSSVNAEVSTLKD
TR
Download sequence
Identical sequences ENSMMUP00000026157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]