SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026287 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026287
Domain Number 1 Region: 414-527
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-31
Family SH2 domain 0.000000631
Further Details:      
 
Domain Number 2 Region: 145-238
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.19e-28
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026287
Domain Number - Region: 292-341
Classification Level Classification E-value
Superfamily PH domain-like 0.00114
Family Pleckstrin-homology domain (PH domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026287   Gene: ENSMMUG00000019992   Transcript: ENSMMUT00000028097
Sequence length 530
Comment pep:known chromosome:MMUL_1:3:75659843:75769873:1 gene:ENSMMUG00000019992 transcript:ENSMMUT00000028097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKVEQTPRSQQDPAGPGLPAQSDRLTHHQEDDVDLEALVNDMNASLDSLYSACSMQSDTV
PLLQNGQHDRSQPRASGPRSVQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAI
PNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLV
YKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNP
MNFFPEQMVTWCQQSNGSQSQLLQEPRHLQLLADLEDSNIFSLIAGRKQYSAPTDHGLCI
KPNKVRNEAKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLSPFSTPV
RSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLS
TVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQI
LPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL
Download sequence
Identical sequences ENSMMUP00000026287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]