SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026310 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026310
Domain Number 1 Region: 556-672
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-22
Family Cadherin 0.0023
Further Details:      
 
Domain Number 2 Region: 120-235
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-21
Family Cadherin 0.00029
Further Details:      
 
Domain Number 3 Region: 333-441
Classification Level Classification E-value
Superfamily Cadherin-like 9.82e-19
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 245-340
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000111
Family Cadherin 0.0014
Further Details:      
 
Domain Number 5 Region: 442-559
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000157
Family Cadherin 0.0015
Further Details:      
 
Domain Number 6 Region: 34-126
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000236
Family Cadherin 0.0043
Further Details:      
 
Domain Number 7 Region: 661-765
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000614
Family Cadherin 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026310   Gene: ENSMMUG00000020010   Transcript: ENSMMUT00000028122
Sequence length 832
Comment pep:known_by_projection chromosome:MMUL_1:8:96710268:96775204:-1 gene:ENSMMUG00000020010 transcript:ENSMMUT00000028122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTF
ELTGETDNIFKIEREGLLYYTKALDRETRSTHNLQVAALDANGAIVEGPVPITIEVKDVN
DNRPTFLQSKYEGSVRQNSRPGKPFLYVNATDLDDPATPNGQLSYQIVIQLPMINNVMYF
QINNKTGGISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWK
APEPVEMVENSTDPHPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDR
EEKDAYVFYAVAKDEYGKPLSYPLEIHVKVQDINDNPPTCPSPVTVFEVQENERLGNSIG
ALTAHDSDEENTANSLLNYRIVEQTPKLPMDGLFLIQTYAGMLQLAKQSLKKQDTPQYNL
TIEVSDKDFKTLCFVQINVIDINDQIPIFEKSDYGNLTLAEDTNVGSTILTIQATDADEP
FTGSSKILYHVIKGDSEGRLGVDTDPHTNTGYVIIKKPLDFETAAISNIVFKAENPEPLV
FGVTYNASSFAKFTLFVTDVNEAPEFSQYVFQAKVSEDVAIGTKVGNVTAKDPEGLDISY
SLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSQFHLILTDV
NDNPPRLAKDYMDLYFCHPLSAPGSLIFEATDDDQHLFRGPHFTFSIASESLQNDWQVSK
INGTHARLSTRHTDFEEKEYVVSIRINDGGRPPLESTVSLTVTFCSCGEDGCFRPAGHQP
GIPTVGMAVGILLTTLLVIGIILAVVFIRMKTDKGKDNVESAQASEVKPLRS
Download sequence
Identical sequences F7GJC2
XP_001087601.1.72884 XP_015001181.1.72884 ENSMMUP00000026310 ENSMMUP00000026310 9544.ENSMMUP00000026310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]