SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026358 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026358
Domain Number 1 Region: 88-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000925
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 171-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000113
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 134-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026358
Domain Number - Region: 57-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00525
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 30-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.084
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026358   Gene: ENSMMUG00000020038   Transcript: ENSMMUT00000028171
Sequence length 317
Comment pep:known_by_projection chromosome:MMUL_1:7:163989994:164014680:1 gene:ENSMMUG00000020038 transcript:ENSMMUT00000028171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATEALLRVLLLLLAFGHSTHGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTS
PGCLHGLCEEPWQCICTDGWDGKLCDRDVRACSSTPCANNGTCVSLDDGLYECSCAPGYS
GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE
NDGVCTDIGGDFRCRCPAGFIDKTCSRPLPVPQPEHRVLKVSMKELNKNTPLLTEGQAIC
FTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNRMLRKKKNLLLQYNSGEDLAVNIIFP
EKIDMTTFSKEAGGEEI
Download sequence
Identical sequences ENSMMUP00000026358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]