SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026478 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026478
Domain Number 1 Region: 128-270
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-27
Family Cadherin 0.0000453
Further Details:      
 
Domain Number 2 Region: 361-487
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-26
Family Cadherin 0.00032
Further Details:      
 
Domain Number 3 Region: 252-368
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-18
Family Cadherin 0.00022
Further Details:      
 
Domain Number 4 Region: 41-140
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000685
Family Cadherin 0.00094
Further Details:      
 
Domain Number 5 Region: 484-577
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000143
Family Cadherin 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026478
Domain Number - Region: 19-52
Classification Level Classification E-value
Superfamily Cadherin-like 0.0612
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026478   Gene: ENSMMUG00000020114   Transcript: ENSMMUT00000028296
Sequence length 608
Comment pep:known chromosome:MMUL_1:20:80996354:81927371:1 gene:ENSMMUG00000020114 transcript:ENSMMUT00000028296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELVIVGGRDIQGSLQDIFKFARTSPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDS
DRPERSKFRLTGKGVDQEPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTL
EGPVPLEVIVIDQNDNRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYN
IRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTG
TATATIMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIING
NPGQSFEIHTNPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVH
ITVLDVNEGPVFYPDPMMVTRQENISVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLN
INPINGTVDTTAVLDRESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFI
YPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVS
LLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSLLLL
SLFSLACL
Download sequence
Identical sequences ENSMMUP00000026478 ENSPANP00000017549 9544.ENSMMUP00000026478 ENSMMUP00000026478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]