SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026490 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026490
Domain Number 1 Region: 46-335
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.11e-108
Family Bee venom hyaluronidase 0.0000529
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026490
Domain Number - Region: 398-417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00165
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026490   Gene: ENSMMUG00000020121   Transcript: ENSMMUT00000028308
Sequence length 420
Comment pep:known chromosome:MMUL_1:2:86115274:86118343:1 gene:ENSMMUG00000020121 transcript:ENSMMUT00000028308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPFSPKVVLDHSRAMAAHLLPICTLFLTLLDMAQGSRGPLLPNRPFATVWNANTQWCLE
RHSVDVDVSIFDVVANPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAH
LARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPVT
QVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGI
RAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLP
YVQIFYDMTNHFLPLESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSSHGRCVRRPSH
PKALLILNPASFSIQLTPDGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQGPWCEQKSMW
Download sequence
Identical sequences ENSMMUP00000026490 XP_001102322.2.72884 XP_005547266.1.63531 XP_011737741.1.29376 XP_011848655.1.47321 XP_011889210.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]