SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026492 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026492
Domain Number 1 Region: 6-57
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00000000000124
Family Bee venom hyaluronidase 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026492
Domain Number - Region: 120-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000237
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026492   Gene: ENSMMUG00000020121   Transcript: ENSMMUT00000028310
Sequence length 142
Comment pep:known chromosome:MMUL_1:2:86115274:86118343:1 gene:ENSMMUG00000020121 transcript:ENSMMUT00000028310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPFSPKDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTS
GALLCSQALCSSHGRCVRRPSHPKALLILNPASFSIQLTPDGGPLSLRGALSLEDQAQMA
VEFKCRCYPGWQGPWCEQKSMW
Download sequence
Identical sequences ENSMMUP00000026492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]