SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026493 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026493
Domain Number 1 Region: 31-350
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.63e-123
Family Bee venom hyaluronidase 0.0000162
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026493
Domain Number - Region: 413-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00171
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026493   Gene: ENSMMUG00000020121   Transcript: ENSMMUT00000028311
Sequence length 435
Comment pep:known chromosome:MMUL_1:2:86115274:86118343:1 gene:ENSMMUG00000020121 transcript:ENSMMUT00000028311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHLLPICTLFLTLLDMAQGSRGPLLPNRPFATVWNANTQWCLERHSVDVDVSIFDVVA
NPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAP
DFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPVTQVEAVAQDQFQGAAR
AWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSR
ALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDMTNHFLPL
DELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQ
ALCSSHGRCVRRPSHPKALLILNPASFSIQLTPDGGPLSLRGALSLEDQAQMAVEFKCRC
YPGWQGPWCEQKSMW
Download sequence
Identical sequences A0A2K5N3X2 A0A2K5ZUK8 A0A2K6CTA0 F7GHW3 G7NXS8
XP_011848654.1.47321 ENSMMUP00000026493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]