SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026513 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026513
Domain Number 1 Region: 43-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.01e-37
Family SCAN domain 0.0000713
Further Details:      
 
Domain Number 2 Region: 354-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.79e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 536-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 399-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-16
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 770-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 697-750
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000161
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 8 Region: 220-260
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000327
Family KRAB domain (Kruppel-associated box) 0.0023
Further Details:      
 
Domain Number 9 Region: 641-696
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000141
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026513
Domain Number - Region: 742-768
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.02
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026513   Gene: ENSMMUG00000020141   Transcript: ENSMMUT00000028333
Sequence length 838
Comment pep:known chromosome:MMUL_1:3:46715242:46735958:1 gene:ENSMMUG00000020141 transcript:ENSMMUT00000028333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMTESREVIDLDPPAETSQEQEDLLIVKVEEEDCTWMQEYNPPTFETFYQRFRHFQYHE
ASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPEEFQPWVREHHPESGEE
AVAVIENIQRELEERRQQVSQREAIRAVKERSERSAEQGYPVTSCHSSKEKQYPLCRRIW
LQCTLPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEVADVAVSFILEEWGHLDQSQKS
LYRDDRKENYGSITSMGYESRDNMELIVKQISDDAESHWVAPEHTERSVPQDPDFAEVSD
LKGMVQRWQVNPTVGKSRQNPSQKRNPDVITDLSPKQSTHGERGHRCSDCGKFFLQASNF
IQHRRIHTGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKPYKCQVCGKAFRVSSHLVQHH
SVHSGERPYGCNECGKNFGRHSHLIEHLKRHFREKSQRCTDKRSKNTKLSVKKKISEYSE
ADMELSGKTQRNVSQVQDFGEGYELQSKLDRKQGIPMKEIVGQPSSKRMNYSEVPYVHKK
SSTGERPHKCNECGKSFIQSAHLIQHQRIHTGEKPFRCEECGKSYNQRVHLTQHQRVHTG
EKPYTCPLCGKAFRVRSHLVQHQSVHSGERPFKCNECGKGFGRRSHLAGHLRLHSREKAH
QCRECGEIFFQYVSLIEHQVLHMGQKNEKHGVCEEAYSWNLTVIEDKKIELQEQPYQCDI
CGKAFGYSSDLIQHYRTHTAEKPYQCDTCRENVGQCSHTKQHQKIYSSTKSHQCHECGRG
FTLKSHLNQHQRIHTGEKPFQCKECGMNFSWSCSLFKHLRSHERTDPINTLSVEGSLL
Download sequence
Identical sequences ENSMMUP00000026513 ENSMMUP00000026513 9544.ENSMMUP00000026513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]