SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026576 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026576
Domain Number 1 Region: 19-401
Classification Level Classification E-value
Superfamily L domain-like 5.21e-68
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026576
Domain Number - Region: 589-668
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0189
Family Fibronectin type III 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026576   Gene: ENSMMUG00000020183   Transcript: ENSMMUT00000028398
Sequence length 811
Comment pep:known_by_projection chromosome:MMUL_1:3:97251585:97254020:1 gene:ENSMMUG00000020183 transcript:ENSMMUT00000028398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAARAVRFLLVVCSCLALPPRAKPVCPERCDCQHPQHLLCTNRGLRVVPKTSSLPSPHD
VLTYSLGGNFITNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQ
ALAPGTLAPLRKLRILYANGNEIGRLSRGSFEGLESLVKLRLDGNALGELPDAVFAPLSN
LLYLHLESNRIRFLGKNAFAQLGKLRFLNLSANELQPSLRHAATFAPLRSLSTLILSANS
LQHLGPRVFQHLPRLGLLSLRGNQLRHLAPEAFWGLEALRELRLEGNRLSQLPTALLEPL
HSLEALDLSGNELSALHPATFGHLGRLRELSLRNNALSALSGDIFAASPALYRLDLDGNG
WTCDCRLRGLKRWMGDWHSQGRLLTVFVQCRHPPALRGKYLDYLDDQQLQNGSCADPLPS
ASLTADRRRRPLPTAAGEEMTPPAGLAEELPPQPQLQQQGGFLAGVAWDGASRELVGNRS
ALRLSWRGPGFQQPSPSAAAAAGPAPQFLDRHEKSQRGRPTPADPVHAEPTPTASPGSAA
SPAGDPWQRATKQRLGTEHQERAAQSDVGAGLPPLVSDPCDFNKFILCNLTVEAVGADSA
SVRWAVREHRSPRPLGGARFRLLFDRFGQQPKFHRFVYLPERSDSATLRELRGDTPYLVC
VEGVLGGRVCPVAPRDHCAGLVTLPEAGSRGGVDYQLLTLALLTVNALLVLLALAAWASR
WLRRKLRARRKGGAPVHVRHMYSTRRPLRSMGTGVSADFSGFQSHRPRTTVCALSEADLI
EFPCDRFMDSAGGGAGGSLRQEDHLLQRFAD
Download sequence
Identical sequences F6WTX8
ENSMMUP00000026576 ENSMMUP00000026576 9544.ENSMMUP00000026576 XP_001088293.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]