SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026588 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026588
Domain Number 1 Region: 1008-1090
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 1094-1181
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-18
Family I set domains 0.05
Further Details:      
 
Domain Number 3 Region: 706-765
Classification Level Classification E-value
Superfamily BPTI-like 1.77e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0025
Further Details:      
 
Domain Number 4 Region: 874-955
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000138
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 275-333
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000012
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 6 Region: 339-397
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000523
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 7 Region: 27-75
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.00094
Further Details:      
 
Domain Number 8 Region: 396-448
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000051
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 9 Region: 460-504
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000589
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026588   Gene: ENSMMUG00000020195   Transcript: ENSMMUT00000028412
Sequence length 1237
Comment pep:known_by_projection chromosome:MMUL_1:7:136355574:136389070:1 gene:ENSMMUG00000020195 transcript:ENSMMUT00000028412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLLLPLLLAPAPGSSAPKVRRQSDTWGPWGQWSPCTRTCGGGVSFRERPCYSQRRDG
GASCVGPARSHRSCRTESCPDGARDFRAEQCAEFDGAEFQGRRYRWLPYYGAPNKCELNC
IPKGENFYYKHREAVVDGTPCEPGKRDVCVDGSCRVVGCDHELDSSKQEDKCLQCGGDGT
TCYPVTGTFDANDLSRAVKNVRGEYYLNGHWTIEAARALPAASTILHYERGAEGDLAPER
LHARGPTSEPLVIELISQEPNPGVHYEYHLPLRHPGPGFSWSHGSWSDCSVECGGGHQSR
LVFCTIDHEAYPDHMCQRQPRPADRRSCNLHPCPETKRWKAGPWAPCSASCGGGSQSRSV
YCISSDGTGVQEAVEEAECSGLPGKPPAIQACNLQRCAAWSPEPWGECSVSCGVGVRRRS
VTCRGHGGSLLQTAACSLEDRPPLSEPCPHLGSLSPTPGPQCSKSCSSGTRRRQVICAIG
PPSHCGSLQHSKPVDVEPCNTQPCHLPQEVPSMQDVHTPASNPRMPLGPQESSALDSRGQ
WWAAQEHPSAGGDHRGERGTHLSALGPAPSLQQPLHQRPLQSGSGPHDCRHSPHGCCPDG
HTASLGPQWQGCPGVSCQQSRYGCCPDRVSVAEGPHHAGCTKLYGSDSTRSRPRSRAVAS
TVHNTHQPQAQQNEPSECRGSQFGCCYDNVAAAAGPLGEGCVGQPSHAYPVRCLLPSAHG
SCADWAARWYFIASVGQCNRFWYGGCHGNANNFASEQECMSSCQGSLHGPRRPQPGASGR
STHTVGGSSSPAGEQEPSQHRTGAVVQRKPWPSGGLWRQDQQPGQGEAPHTQAFGEWPWG
QELEPRAPGLGGDAGSPAPPFHSSSYRISLAGVEPSLVQAVLGQLVRLSCSDDTAPESQA
AWQKDGQPISSDRHRLQSDGSLIIHPLQAEDEGTYSCGSTRPGHDSQKIQLRIIGNDMAV
LSEAELSRIPQPRDPGQDFGQAGAAGALGAIPSSHTQPANRLRLDQNQPRVVDASPGQRI
RMTCRAEGFPPPAIEWQRDGQPVSSPRHQLQPDGSLVISRVAVEDGGFYTCVASNGRDRD
QRWVQLRVLGELTISGLPPTVTVAEGDTARLLCVVAGESVNIRWSRNGLPVHADGHRVHQ
SPDGTLLIYNLRVRDEGSYTCSAYQGSQAVSRSTEVKVVSPAPTTQPRDPGRECIDQPEL
ANCDLILQAQLCGNEYYSSFCCASCSRFQPHAQPIWQ
Download sequence
Identical sequences ENSMMUP00000026588 9544.ENSMMUP00000026588 ENSMMUP00000026588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]