SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026637 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026637
Domain Number 1 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-27
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 300-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.18e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 411-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.5e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 2-45
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 457-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 160-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-18
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 262-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000192
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026637   Gene: ENSMMUG00000020234   Transcript: ENSMMUT00000028465
Sequence length 511
Comment pep:known_by_projection chromosome:MMUL_1:19:58360696:58370494:1 gene:ENSMMUG00000020234 transcript:ENSMMUT00000028465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHLTFRDVAIEFSQAEWKCLDPAQRALYKDVMLENYRNLVSLGEDCAPAEAGICPCQMRQ
ILVFSSDSKHARIMGSEFYSFLAFLGSSYALGSNAKDKPIKKQLGVSFHLHLSELELFPD
ERVINGCNQVENFINHSSFVSSLQEISSSVKTPIFNRNDFDDSSFLPQEQKEHIGEKPYE
CNEHSKVFRVSSSLTKHQVIHTAEKPYKCNECGKVFSRNSHLAEHWRIHTGEKPYKCNDC
GKVFSYNSNFARHQRIHTREKPFECNECGKVFSNNSYLARHQKIHAEEKPYKCNECGKGF
SHKSSLANHWRIYTGEKPYKCDECGKAFYRIALLVRHQKIHTGEKPYKCNECGKVFIQNS
HLAQHWRIHTGEKPYKCNECGKVFNQLSNLARHRRIHTGEKPYKCNECGKAFSEYSGLSA
HLVIHTGEKPYKCNECGKAFRHKLSLTNHQRIHTGERPYKCNECGKVFNRIAHLARHRKI
HTGEKPYKCSECGKAFSRISYLTQHWTIHMG
Download sequence
Identical sequences ENSMMUP00000026637 ENSMMUP00000026637 9544.ENSMMUP00000026637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]