SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026792 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026792
Domain Number 1 Region: 17-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-90
Family Calponin-homology domain, CH-domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 2211-2332
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-35
Family Pleckstrin-homology domain (PH domain) 0.00000182
Further Details:      
 
Domain Number 3 Region: 297-419
Classification Level Classification E-value
Superfamily Spectrin repeat 9.81e-34
Family Spectrin repeat 0.0000609
Further Details:      
 
Domain Number 4 Region: 907-1062
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-30
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 1644-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 4.7e-27
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1014-1168
Classification Level Classification E-value
Superfamily Spectrin repeat 1.09e-26
Family Spectrin repeat 0.0000346
Further Details:      
 
Domain Number 7 Region: 1855-2010
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-25
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 8 Region: 1226-1379
Classification Level Classification E-value
Superfamily Spectrin repeat 2.23e-25
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 9 Region: 697-813
Classification Level Classification E-value
Superfamily Spectrin repeat 4.53e-25
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 10 Region: 532-640
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-21
Family Spectrin repeat 0.00074
Further Details:      
 
Domain Number 11 Region: 820-947
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-21
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 12 Region: 1482-1594
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-20
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 13 Region: 429-527
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-19
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 14 Region: 1381-1493
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-18
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 15 Region: 2015-2075
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000475
Family Spectrin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026792   Gene: ENSMMUG00000020359   Transcript: ENSMMUT00000028635
Sequence length 2390
Comment pep:known_by_projection chromosome:MMUL_1:14:7737185:7774522:1 gene:ENSMMUG00000020359 transcript:ENSMMUT00000028635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVD
KALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKD
ALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNA
FNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHA
MEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFT
EKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQ
EKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGR
VQAVDAVAAELAAERYHDIKRIAARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDL
LYLMDWMEEMKGRLQSQDLGKHLTGVEDLLQLHELVEADIAVQAERVRAVSASALRFCNP
GKEYRPCDPQLVSERVAKLEQSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQ
QHLLASADTGRDLTGVLRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASA
RAAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEF
STQALARQHRALEEEIRSHRPTLDALREQAAALPPALSRTPEVQGRVPTLERHYEELQAR
AGKRARALEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPE
MNTLAAQITAVNDVAEQLLKASPPGKDRIVNTQEQLNHRWQQFRSLADGKKAALTSALSI
QNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIASRVGELTR
EANALAAGHPAQAAAINARLREVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAW
LGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADPQC
LFLRQRLEALGTGWEELGRMWESRQSRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEM
PGTLQAADAAIKKLEDFMSTMDANGERIHGLLEAGRQLVSEGNIHADKIREKADSIERRH
RKNQDAAQQFLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQ
AFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLGDLHRCWDELETTTQAKARSLF
DANRAELFAQSCCALESWLESLQAQLHSDDYGKDLTSVNILLKKQQMLEWEMAVREKEVE
AIQAQAKALAQEDQGAGEVERTSRAVEEKFRALCQPMQERCRRLQASREQHQFHRDVEDE
ILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADLRERQRALGAAAAG
PELAQLQEMWKRLGHELELRGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDE
LSAQAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHEHPESTRISIRQAQVDKLYAGLK
ELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFS
RDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAA
YELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSAQVQQVQ
DDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELM
LWMDEVNLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGKELLARSHYA
AEEISEKLSQLQARRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAE
LGCTVDEVESLIKRHEAFQKSAVAWEERFCALEKLTALEEREKERKRKREEEERRKQPPA
PESTASVPPGDLVGGQTAPDTTWDRTQLRPPPSTQAPSVNGVCTDGEPSQPLLGQQRLED
SSSPEGPGPGPGDEANGPRGDRQTRTRGAAPPAMPQSRSTESAHAATLPPRGPEPSAQEQ
MEGVLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPVSLAR
AQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEP
VVPSTTRGMTRAMTMPPVSPVGAEGPVVLRSKDGREREREKRFSFFKKNK
Download sequence
Identical sequences ENSMMUP00000026792 9544.ENSMMUP00000026792 ENSMMUP00000026792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]