SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026987 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026987
Domain Number 1 Region: 304-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 528-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 6 Region: 569-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 416-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 8-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-20
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 9 Region: 210-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000436
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 10 Region: 89-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000418
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026987
Domain Number - Region: 164-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00127
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026987   Gene: ENSMMUG00000020493   Transcript: ENSMMUT00000028840
Sequence length 627
Comment pep:known chromosome:MMUL_1:19:63713989:63720730:-1 gene:ENSMMUG00000020493 transcript:ENSMMUT00000028840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAELTAPAQGVVTFEDVAVYFSWKEWGLLDEAQKCLYHDVMLENLTLTTSLGGCGAGD
EEAPYQQSTSSQRVSQVRLPKALPSPQKTNPCEICGPVLREILHLLEHQGTHHGQKLYTD
GACRKQLQFTAYLHQHQKQHVGQKHFRSNGGRDMFLNSCTFEVSGKPFTCKEVGKDFLAR
SRFLQQQATHTRKKSNRTKSAVAFHSVKNHYNWGECVKAFSYKHVRVQHQGDLIRERSYM
CSECGKSFSTSCSLSDHLRVHTSEKPYTCGECGKSYRQSSSLITHRRVHTGVRPHQCDEC
GKLFNRKYDLLIHQRVHTGERPYKCSECGKSFSHSSSLITHQRIHTGMRPYECSECGKSF
IHSSSLITHQRVHTGTKPYMCSECGKSFSQSCHLIKHRRLHIGEGPYECSECGKLFTYRS
RFFQHQKVHTGVRSHECHECGKLFSRKFDLIVHERVHTGERPYECSECGKSFTCKSYLIA
HWKVHTGARPYECGECGKSFTHSSTLLQHQRVHTGERPYECNECGKFFSQSSSLIRHRRS
HTGERPYKCGECWKSFSNRSSLVKHQRVHTGERPYECSECGKSFSQSSNLSNHQRVHSGE
RPYECSDCGKSFTFNSNLLKHQHVHKG
Download sequence
Identical sequences F6VJ66 G7PZA9
XP_005590619.1.63531 XP_014980532.1.72884 ENSMMUP00000026987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]