SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027002 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027002
Domain Number 1 Region: 154-241
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.01e-35
Family SCAN domain 0.0000523
Further Details:      
 
Domain Number 2 Region: 8-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 544-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.48e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 585-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 281-336
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 507-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 462-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000302
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027002   Gene: ENSMMUG00000020505   Transcript: ENSMMUT00000028856
Sequence length 653
Comment pep:known_by_projection chromosome:MMUL_1:19:63948529:63980461:1 gene:ENSMMUG00000020505 transcript:ENSMMUT00000028856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRLPTAWSCEPVNFEDVTLGFTPEEWGLLDLKQKSLYREVMLENYRNLVSVEHQLSKP
DVVSQLEEAEDFWPVERGIPQDTIPEYSELQLDPKLDPLPAESPLMNIEVVEVLTLNQEV
AGPRNAQIQALYAEDGSLSPDAPSEEVQQQGKHPGDPEAARQRFRQFRYKDMTGPREALD
QLRQLCHQWLQPEARSKEQILELLVLEQFLGALPVKLRTWVESQHPENCQEVVALVEGVT
WISEEEVLPAGQPAEGTTCCLEVTAQQEEKQEDAAICPVTVLSEEPVTFQDVAVDFSREE
WGLLGPTQRTEYRDVMLETFGHLVSVGWETTLENKELAPNSDIPQEEPAPSLKVQESSRD
CTLSSTLEDTLQGGVQEVQETVLKQVESAKEKDLPQKKHFDNHESQANSGTLDTNQVSLQ
KIDSVESQVNNGALNTNQVLLQKIPPRKQLRKCDSQVKSMKHNSRVKIHQKSYERQKAKE
GNGCRKTFSRSAKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHTGERPYVCQAC
GKGFVQSSSLTQHQRVHSGERPFECHECGRTFNDRSAISQHLRTHTGAKPYKCQDCGKAF
RQSSHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS
Download sequence
Identical sequences Q4R8H9
ENSMMUP00000027002 9544.ENSMMUP00000027002 NP_001270154.1.63531 XP_005590640.1.63531 ENSMMUP00000027002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]