SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027007 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027007
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-26
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027007   Gene: ENSMMUG00000020509   Transcript: ENSMMUT00000028861
Sequence length 75
Comment pep:novel chromosome:MMUL_1:19:64042054:64042550:1 gene:ENSMMUG00000020509 transcript:ENSMMUT00000028861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEPVTFRDVAVDFTQEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQGT
ELWVAERGTIQGCHP
Download sequence
Identical sequences ENSMMUP00000027007 9544.ENSMMUP00000027007 ENSMMUP00000027007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]