SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027082 from Macaca mulatta 76_1

(show help)
Strong hits

Sequence:	ENSMMUP00000027082
Domain Number 1	Region: 181-249
Classification Level	Classification	E-value
Superfamily	Homeodomain-like	7.27e-18
Family	Homeodomain	0.0000547
Further Details:

Domain Number 2	Region: 54-120
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	2.14e-16
Family	LIM domain	0.022
Further Details:

Domain Number 3	Region: 22-52
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000015
Family	LIM domain	0.018
Further Details:

Weak hits

Sequence:	ENSMMUP00000027082
Domain Number -	Region: 117-143
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00304
Family	LIM domain	0.025
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	Protein: ENSMMUP00000027082 Gene: ENSMMUG00000020567 Transcript: ENSMMUT00000028939
Sequence length	359
Comment	pep:known_by_projection chromosome:MMUL_1:7:55323899:55329718:1 gene:ENSMMUG00000020567 transcript:ENSMMUT00000028939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQ YLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVC SRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGSRGLHLPDAGSGRQPAL RPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQ NKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPP WKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Download sequence
Identical sequences	A0A0D9RQB4 A0A2K5JS25 A0A2K5M8G6 A0A2K5V3G6 A0A2K6B824 9544.ENSMMUP00000027082 ENSMMUP00000027082 XP_001105068.1.72884 XP_005560211.1.63531 XP_008013955.1.81039 XP_011755384.1.29376 XP_011788214.1.43180 XP_011948869.1.92194 ENSMMUP00000027082

SEARCH