SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027091 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027091
Domain Number 1 Region: 33-88
Classification Level Classification E-value
Superfamily BPTI-like 5.68e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0000844
Further Details:      
 
Domain Number 2 Region: 154-209
Classification Level Classification E-value
Superfamily BPTI-like 7.52e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0015
Further Details:      
 
Domain Number 3 Region: 91-151
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000312
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027091   Gene: ENSMMUG00000020581   Transcript: ENSMMUT00000028952
Sequence length 235
Comment pep:known chromosome:MMUL_1:3:123356230:123361461:1 gene:ENSMMUG00000020581 transcript:ENSMMUT00000028952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPTRPLELSILLLLLTEAALGDAAQEPTGNNAEICLLPLDYGPCRALLPRYYYDRYTQR
CRQFLYGGCEGNANNFYTWEACDEACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSM
TCEKFSSGGCHRNWIENRFPDEVTCMAFCAPKKSPSFCYSPKDEGLCSANVTRYYFNPRY
KTCDAFTYTGCGGNDNNFVSREDCRRACAKALKRKKKIPKFRFASRIRKIRKKQF
Download sequence
Identical sequences A0A096NZZ0 A0A2K5VB20 A0A2K6DRJ3 F7CWN2
ENSMMUP00000027091 ENSPANP00000018665 ENSMMUP00000027091 9544.ENSMMUP00000027091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]