SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027192 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027192
Domain Number 1 Region: 80-360
Classification Level Classification E-value
Superfamily L domain-like 1.02e-52
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 417-496
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000189
Family Fibronectin type III 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027192
Domain Number - Region: 34-78
Classification Level Classification E-value
Superfamily L domain-like 0.000221
Family Ngr ectodomain-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027192   Gene: ENSMMUG00000020664   Transcript: ENSMMUT00000029064
Sequence length 660
Comment pep:known chromosome:MMUL_1:7:148805071:148894927:1 gene:ENSMMUG00000020664 transcript:ENSMMUT00000029064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQTTKWPSHGAFFLKSWLIISLGLYSQVSKLLACPSVCRCDRNFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPV
DLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIADGTFSHLTKLKEFSIVRN
SLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLS
NLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAVRELNMNLLSC
PTTTPGLPLFTPAPSTASPTTQPPTLSIPNPSRSHTPPTPTTSKLPTIPDWDGRERVTPP
ISERIQLSIHFVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSL
VNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSP
FLLAGLIGGAVIFVLMVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSIL
EMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
Download sequence
Identical sequences A0A2K6AU17 F7BEN4 G7PB44
NP_001253402.1.72884 XP_005562015.1.63531 XP_005562016.1.63531 XP_011715627.1.29376 XP_011715628.1.29376 XP_011715629.1.29376 XP_014999750.1.72884 XP_014999751.1.72884 XP_015309554.1.63531 9544.ENSMMUP00000027192 ENSMMUP00000027192 ENSMMUP00000027192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]