SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027233 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027233
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.99e-22
Family Ribosomal protein L24e 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027233   Gene: ENSMMUG00000020693   Transcript: ENSMMUT00000029107
Sequence length 163
Comment pep:known chromosome:MMUL_1:7:33524544:33540396:-1 gene:ENSMMUG00000020693 transcript:ENSMMUT00000029107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG
KELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK
VQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDMEDAP
Download sequence
Identical sequences A0A024R5U8 A0A096NM55 A0A2K5I6X8 A0A2K5MEU3 A0A2K5ZAL4 A0A2K6C5Z0 F6PJJ0 G7PBI5 H2Q9G9 Q9UHA3
ENSP00000260443 ENSPTRP00000012123 NP_001244991.1.72884 NP_001271088.1.63531 NP_057388.1.87134 NP_057388.1.92137 XP_003827904.1.60992 XP_011753505.1.29376 XP_011784037.1.43180 XP_011841891.1.47321 XP_011948445.1.92194 XP_510425.1.37143 ENSPTRP00000012123 ENSMMUP00000027233 Hs10047102___KOG1723 ENSP00000260443 9544.ENSMMUP00000027233 9598.ENSPTRP00000012123 9606.ENSP00000260443 ENSPANP00000014064 gi|10047102|ref|NP_057388.1| ENSMMUP00000027233 ENSP00000260443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]