SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027278 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027278
Domain Number 1 Region: 534-839
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.37e-77
Family FMN-linked oxidoreductases 0.000000000026
Further Details:      
 
Domain Number 2 Region: 9-198
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 2.3e-38
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.0000000531
Further Details:      
 
Domain Number 3 Region: 188-439
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 9.42e-35
Family N-terminal domain of adrenodoxin reductase-like 0.000000479
Further Details:      
 
Domain Number 4 Region: 853-1012
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.54e-29
Family Ferredoxin domains from multidomain proteins 0.000000181
Further Details:      
 
Domain Number 5 Region: 421-507
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00001
Family N-terminal domain of adrenodoxin reductase-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027278   Gene: ENSMMUG00000020726   Transcript: ENSMMUT00000029154
Sequence length 1025
Comment pep:known chromosome:MMUL_1:1:100123971:100984917:-1 gene:ENSMMUG00000020726 transcript:ENSMMUT00000029154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVLSKDSADIESILALNPRTQTHATLRSTSAKKLDKKHWKRNPDKNCFNCEKLENNFD
DIKHTTLGERGALREAMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDN
PLGLTCGMVCPTSDLCVGGCNLYATEEGPINIGGLQQFATEVFKAMSIPQIRNPSLPPPE
KMSEAYSAKIALFGAGPASISCASFLARLGYSDITIFEKQEYVGGLSTSEIPQFRLPYDV
VNFEIELMKDLGVKIICGKSLSVNEMTLSTLKEKGYKAAFIGIGLPEPNKDAMFQGLTRD
QGFYTSKDFLPLVAKGSKAGMCACHSPLPSIRGVVIVLGAGDTAFDCATSALRCGARRVF
IVFRKGFVNIRAVPEEMELAKEEKCEFLPFLSPRKVIVKGGRIAGMQFVRTEQDETGKWN
EDEDQMVHLKADVVISAFGSVLSDPKVKEALSPIKFNRWGLPEVDPETMQTSEPWVFAGG
DVIGLANTTVESVNDGKQASWYIHKYIQSQYGASISAKPELPLFYTPIDLVDISVEMAGL
KFINPFGLASATPATSTSMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPMY
GPGQSSFLNIELISEKTAAYWCQSVTELKADFPDNIVIASIMCSYNKNDWMELAKKSEDS
GADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQAVQIPFFAKLTPNVTDIVSI
ARAAKEGGADGVTATNTVSGLMGLKSDGTPWPAVGIAKRTTYGGVSGTAIRPIALRAVTS
IARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALLYL
KSIEELQDWDGQSPATVSHQKGKPVPRIAELMDKKLPSFGPYLEQRKKIIAENKIRLKEQ
NAAFSPLKRNCFIPKWPVPTVKDVIGKALQYLGTFGELSNVEQVVAMIDEEMCINCGKCY
MTCNDSGYQAIRFDPETHLPTITDTCTGCTLCLSVCPIVDCIKMVSRTTPYEPKRGVPLS
VDPVC
Download sequence
Identical sequences A0A1D5QCM1 A0A2K5V8G2
ENSMMUP00000027278 9544.ENSMMUP00000027278 XP_005542686.1.63531 ENSMMUP00000027279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]