SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027314 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027314
Domain Number 1 Region: 628-914
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-81
Family Protein kinases, catalytic subunit 0.00000000312
Further Details:      
 
Domain Number 2 Region: 31-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-69
Family Ephrin receptor ligand binding domain 0.00000179
Further Details:      
 
Domain Number 3 Region: 328-535
Classification Level Classification E-value
Superfamily Fibronectin type III 1.55e-40
Family Fibronectin type III 0.00000376
Further Details:      
 
Domain Number 4 Region: 934-1001
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.3e-19
Family SAM (sterile alpha motif) domain 0.0000331
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027314
Domain Number - Region: 253-325,360-385
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00016
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027314   Gene: ENSMMUG00000020754   Transcript: ENSMMUT00000029192
Sequence length 1005
Comment pep:known_by_projection chromosome:MMUL_1:1:25152412:25190137:1 gene:ENSMMUG00000020754 transcript:ENSMMUT00000029192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEV
DESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
TFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRGVGPLSKRG
FYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
APAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDV
TYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
LSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEK
DKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDT
RTIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHP
PGKLPEPQFYAEPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGESGEVCYGRLQVPGQR
DVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGS
LDAFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFG
LSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYW
NMTNRDVISSVEEGYRLPAPMGCPRALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPE
SLRATATVSRCPPPAFARSCFDLRGGSGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLG
MVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGPRRHL
Download sequence
Identical sequences F7HEL6
ENSMMUP00000027314 9544.ENSMMUP00000027314 ENSMMUP00000027314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]