SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027373 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027373
Domain Number 1 Region: 48-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.92e-51
Family Calponin-homology domain, CH-domain 0.0000241
Further Details:      
 
Domain Number 2 Region: 2413-2529
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-31
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 
Domain Number 3 Region: 302-422
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-29
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 1568-1724
Classification Level Classification E-value
Superfamily Spectrin repeat 2.19e-29
Family Spectrin repeat 0.00095
Further Details:      
 
Domain Number 5 Region: 849-981
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 6 Region: 431-533
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-22
Family Spectrin repeat 0.00057
Further Details:      
 
Domain Number 7 Region: 1781-1933
Classification Level Classification E-value
Superfamily Spectrin repeat 1.38e-21
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 8 Region: 1253-1405
Classification Level Classification E-value
Superfamily Spectrin repeat 5.64e-20
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 9 Region: 535-641
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-17
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 10 Region: 2014-2111
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-16
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 11 Region: 744-838
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-16
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 12 Region: 1039-1160
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000166
Family Spectrin repeat 0.00091
Further Details:      
 
Domain Number 13 Region: 1169-1268
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000036
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 14 Region: 1369-1475
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000864
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 15 Region: 602-728
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000095
Family Spectrin repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027373
Domain Number - Region: 1945-2048
Classification Level Classification E-value
Superfamily Spectrin repeat 0.032
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027373   Gene: ENSMMUG00000020796   Transcript: ENSMMUT00000029255
Sequence length 2568
Comment pep:known chromosome:MMUL_1:19:46837370:46948323:1 gene:ENSMMUG00000020796 transcript:ENSMMUT00000029255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQIPGEVDNMEGLPASNNNNLATRWESPDRGWEREQPAASTAAASLFECSRIKALADER
EAVQKKTFTKWVNSHLARVGCHIGDLYVDLRDGFVLTRLLEVLSGEQLPRPTRGRMRIHS
LENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQVTLEKEKKRKEKKR
KEKKRGIVEWCVQETSGGYSEARSCHCTPAWATRAKLHLKKKEKKKRLIILPKLLHPSTQ
YLQALCQSAHCLVSHSLFPPDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKVL
DQVLEVGKIIERYEELAAELLAWIHRTVGLISNQKFANSLSGVQQQLQAFTAYCTLEKPV
KFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWGELEKAEHEREAALRAEL
IRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIAAY
EERVQGVAELAQALAAEGYYDIRRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQKVF
QEMVYMVDWMEEMQAQLLSPECGQHLVEADDLLQKHGLLEGDIVAQSERVEALNAAALRF
SQLQGYQPCDPQVICNRVNHVHGCLAELQEQAARRRAELEASRSLWALLQELEEAESWAR
DKERLLEAAGSGGAAGAAGAAGTAGGAHDLSSTARLLAQHKILQGELGGRRALLQQALRC
GEELVAAGGAVGPGAETVQLVGLAERAASARRRWQRLEEAAARRERRLQEARALHQFGAD
LDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRGPVSGLRRQLATLGG
ASGAGPLVVALQVRVVEAEQLFAEVTEVAALRRQWLRDALAVYRMFGEVHACELWIGEKE
QWLLSMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNHTVQELVEGGHPSSDEVRSC
QDHLNSRWNRIVELVEQRKEEMSAVLLVENHVLEVAEVRAQVREKRRAVESAPRAGGALQ
WRLSGLEAALQALEPRQAALLEEAALLAARFPAQAARLHQGAEELGAEWGALASAAQACG
EAVAAAGRLQRFLHDLDAFLDWLVRAQEAAGGSEGPLPNSLEEADALLARHAALKEEVDQ
REEDYARIVAASEALLAADGAELGPGLALDEWLPHLELGWHKLLGLWEARREALVQAHIY
QLFLRDLRQALVVLRNQEMALSGAELPGTVESVEEALKQHRDFLTTMELNQQKMQVAVQA
AEGLLRQGNIYGEQAQEAVTRLLEKNQENQLRAQQWMQKLHDQLELQHFLRDCHELDGWI
HEKMLMARDGTREDSHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQEKPELAASV
RKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKKLLHMESQLQDVDPGGD
LATVNSQLKKLQSMESQVEEWYREVGELQAQTAALPLEPASKELVGERQNAVGERLVRLL
EPLQERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGNGLQAVQQHIKKNQGLR
REIQAHGPRLEEVLERAGALSSLRSPEAEAVRRGLEQLQSAWAGLREAAERRQQALDAAF
QVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQLS
RQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVALEQQYWLYQLSRQVSELEH
WIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASETGTAGRERLAAVNQMVDELIECGHTA
AATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRLT
TPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEVL
QGWKELLSACEDARLHVSSTADALRFHSQVRDLLSWMDGIASQIGAADKPRCPSSLLGLP
ACAASPSQPQPIDSPLPNRMTTATICVAPLCARHCSRCFIQAQLDKLGTRKEEVSEKWDR
HWEWLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAA
WEERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEP
LARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPEIPGRVEHAALPASPEDAAETLA
APAAPVAAEQVRPRPERQESADRAEELPRRRRPERQESVDQSEEAARRRRPERQESAEHE
AAHSLTLGRYEQMERRRERRERRLERQESSEQEMPIRGDLVKGKATLADIVEQLQEKEAG
PGLPAGPSLPQPRELPPGRLPNGLEPPERTPRPDRPRARDRPKPRRRPRPREGGEGGGSR
RSRSAPAQGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELGF
YKDSKGPASGSTHGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMN
GWLEAVAASVAEHAEIARWGQTLPTTSSTDEGNPKREGGDRRASGRRK
Download sequence
Identical sequences 9544.ENSMMUP00000027373 ENSMMUP00000027373 ENSMMUP00000027373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]