SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027441 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027441
Domain Number 1 Region: 86-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.5e-39
Family Glutathione S-transferase (GST), C-terminal domain 0.000000469
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.68e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027441   Gene: ENSMMUG00000020851   Transcript: ENSMMUT00000029328
Sequence length 220
Comment pep:known_by_projection chromosome:MMUL_1:1:112748794:112754256:1 gene:ENSMMUG00000020851 transcript:ENSMMUT00000029328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMTLGYWDIRGLAHVIRLLLEYTDSSYEEKKYSREDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGETEEEKIRVHIMKNQTMDNHMQLVMICHNPEF
ATKLKPKYLEELPEKLKLYSQFLGKRPWFAGDTITFVDFLVYDVLDLHHTFEPKCLDAFP
NLKDFISRFEEAGRKISAYMKSSRFLPRPVFTKMAVWGNK
Download sequence
Identical sequences ENSMMUP00000027441 9544.ENSMMUP00000027441 ENSMMUP00000027441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]