SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027477 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000027477
Domain Number - Region: 1-21
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00318
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027477   Gene: ENSMMUG00000020882   Transcript: ENSMMUT00000029364
Sequence length 83
Comment pep:known_by_projection chromosome:MMUL_1:7:54935796:54942236:-1 gene:ENSMMUG00000020882 transcript:ENSMMUT00000029364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCRCIENYTGARCEEVFLPSSSIQTKNNLFEAFMALAVLITLIIGAFYFLCRKGHFQRAS
SVQYDVSLVETSSTSAHHSEDQQ
Download sequence
Identical sequences ENSMMUP00000027477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]