SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027488 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027488
Domain Number 1 Region: 452-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-26
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 200-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.35e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 396-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 162-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 494-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 726-750,777-804
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000319
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 9 Region: 359-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000185
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 579-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000422
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 11 Region: 673-707
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000478
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 12 Region: 853-883
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000149
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027488   Gene: ENSMMUG00000020891   Transcript: ENSMMUT00000029378
Sequence length 886
Comment pep:known_by_projection chromosome:MMUL_1:20:28858173:28860988:-1 gene:ENSMMUG00000020891 transcript:ENSMMUT00000029378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPQGPWNAAVLSSGMEPETALWGPDLQGPEQSPNDAHRGAESENEEESPRQESSGEEIIM
GDPAQSPESKDSIEMSLERPSQDPSVTQNPPTPLAHSNPLDHQTPLDPPAPEVVPTPSDW
TKACEASWQWGALTTWNSPPVVPTNEPSLRELVQGRPAGAEKPYICNECGKSFSQWSKLL
RHQRIHTGERPNTCSECGKSFTQSSHLVQHQRTHTGEKPYKCPDCGKCFSWSSNLVQHQR
THTGEKPYKCTECEKAFTQSTNLIKHQRSHTGEKPYKCGECRRAFYRSSDLIQHQATHTG
EKPYKCPECGKRFGQNHNLLKHQKIHAGEKPYRCTECGKSFIQSSELTQHQRTHTGEKPY
ECLECGKSFGHSSTLIKHQRTHLREDPFKCPVCGKTFTLSATLLRHQRTHTGERPYKCPE
CGKSFSVSSNLINHQRIHRGERPYICADCGKSFIMSSTLIRHQRIHTGEKPYKCSDCGKS
FIRSSHLIQHRRTHTGEKPYKCPECGKSFSQSSNLITHVRTHMDENLFVCSDCGKAFLEA
HELEQHRVIHERGKTPARRAQGDALLGLGDPSLLTPPPGAKPHKCLVCGKGFNDEGIFMQ
HQRIHIGENPYKNADGLIAHPAPKPPQLRSPRLPFRGNSYPGAAEGRADAPGQPLKPPEG
QEGFGQRRGLLSSKTYICSHCGESFLDRSVLLQHQLTHGNEKPFLFPDYRIGLGEGAGPS
PFLSGKPFKCPECKQSFGLSSELLLHQKVHAGGKSSQKSTELGKSSSVLLEHLRSPLGAR
PYSCSDCGASFLDRVALTRHQETHTQEKSPSPEDPPPEAATLSTGQEGEGEAPTPTGSSS
HGEGEEGESPKTRVEEKPYLCPECGDGFTEVAALLLHRSCHPGVSL
Download sequence
Identical sequences ENSMMUP00000027488 ENSMMUP00000027488 9544.ENSMMUP00000027488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]