SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027515 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027515
Domain Number 1 Region: 2-29
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000275
Family L-aminoacid/polyamine oxidase 0.0075
Further Details:      
 
Domain Number 2 Region: 88-122
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000393
Family FAD-linked reductases, N-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027515   Gene: ENSMMUG00000020912   Transcript: ENSMMUT00000029407
Sequence length 130
Comment pep:known chromosome:MMUL_1:10:37523661:37527418:1 gene:ENSMMUG00000020912 transcript:ENSMMUT00000029407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGNPNIPKPRRILRSAWGSNPYFRGSYSYTQVGSSGADVEKLAKPLPYTESSKTAHGSST
KQQPGHLFSSKCPEQPLDANRGAVKPMQVLFSGEATHRKYYSTTHGALLSGQREAARLIE
MYRDLFQQGT
Download sequence
Identical sequences ENSMMUP00000027515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]