SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027532 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027532
Domain Number 1 Region: 47-259
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.77e-60
Family Proteasome subunits 0.00000000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027532   Gene: ENSMMUG00000020924   Transcript: ENSMMUT00000029425
Sequence length 264
Comment pep:known chromosome:MMUL_1:1:129833677:129836060:1 gene:ENSMMUG00000020924 transcript:ENSMMUT00000029425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVK
FEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEE
LLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAP
SLATGYGAYLAQPLLREVLEKQPVLSQTEARNLVERCMRVLYYRDARSYNRFQIATVTEK
GVEIEGPLSAETNWDIAHMISGFE
Download sequence
Identical sequences A0A2K5JPA4 A0A2K5N3U3 A0A2K6B931 A0A2K6P367 A9X1A3 F7H4P3 G8F2D0
ENSPANP00000001937 NP_001252633.1.72884 XP_010385465.1.97406 XP_011767634.1.29376 XP_011793266.1.43180 XP_011924991.1.92194 XP_015307297.1.63531 ENSMMUP00000027532 ENSMMUP00000027532 9544.ENSMMUP00000027532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]