SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027536 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027536
Domain Number 1 Region: 2-221
Classification Level Classification E-value
Superfamily t-snare proteins 9.68e-65
Family t-snare proteins 0.0000000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027536   Gene: ENSMMUG00000020926   Transcript: ENSMMUT00000029429
Sequence length 263
Comment pep:known_by_projection chromosome:MMUL_1:11:132080195:132115571:-1 gene:ENSMMUG00000020926 transcript:ENSMMUT00000029429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XHFMEDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTA
NKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSK
GRIQRQLEITGRTTTDDELEEMLESGKPSIFISDIISDSQITRQALNEIESRHKDIMKLE
TSIRELHEMFMDMAMFVETQGEMINNIERNIMNATDYVEHAKEETKKAIKYQSKARRKKW
IIIAVSVVLVAIIALIIGLSVGK
Download sequence
Identical sequences ENSMMUP00000027536 ENSMMUP00000027536 9544.ENSMMUP00000027536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]