SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027577 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027577
Domain Number 1 Region: 9-210,258-368
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.84e-46
Family Calponin-homology domain, CH-domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027577   Gene: ENSMMUG00000020956   Transcript: ENSMMUT00000029472
Sequence length 370
Comment pep:known_by_projection chromosome:MMUL_1:14:59386286:59545514:-1 gene:ENSMMUG00000020956 transcript:ENSMMUT00000029472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLP
LSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLA
EDLYDGQVLQKLFVILSLQWLTWKWITNHEIWAGTNIQTLSNLEEDTVIFQSSFISAVHA
KSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEYACGS
GARERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGL
LEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLY
NLFTKYRNVE
Download sequence
Identical sequences 9544.ENSMMUP00000027577 ENSMMUP00000027577 ENSMMUP00000027577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]