SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027630 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027630
Domain Number 1 Region: 36-569
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.86e-166
Family Gamma-glutamyltranspeptidase-like 0.000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027630   Gene: ENSMMUG00000002288   Transcript: ENSMMUT00000029527
Sequence length 569
Comment pep:known chromosome:MMUL_1:10:68017619:68040278:1 gene:ENSMMUG00000002288 transcript:ENSMMUT00000029527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKRLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSEIGRDALQD
GGSAVDAAIAALLCMGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFASMFN
SSQQSQNGGLSVAVPGEIRGYELAHQRHGRLPWARLFRPSIQLARQGFPVGKGLAAALEN
KRTVIEQQPVLCEVFCRDGKVLREGERLTLPRLADTYETLAIEGAQAFYNGSLTAQIVKD
IQAAGGIVTAEDLNNYRAELIEHPLNISLGDAVLYMPSAPLSGPVLALILNILKGYNFSR
ASVETPEQKGLLYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISD
DTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNDE
MDDFSSPSITNQFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGASGGTQITTA
TALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHDTEIASTF
IAVVQAVVHTPGGWAAASDSRKGGEPAGY
Download sequence
Identical sequences ENSMMUP00000027630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]