SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027631 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027631
Domain Number 1 Region: 44-605
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.45e-156
Family Gamma-glutamyltranspeptidase-like 0.000000463
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027631   Gene: ENSMMUG00000002288   Transcript: ENSMMUT00000029528
Sequence length 605
Comment pep:known chromosome:MMUL_1:10:68024055:68040124:1 gene:ENSMMUG00000002288 transcript:ENSMMUT00000029528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPCGCSRAMKKRLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSE
IGRDALQDGGSAVDAAIAALLCMGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPR
LAFASMFNSSQQSQNVLTGPGWGGLSVAVPGEIRGYELAHQRHGRLPWARLFRPSIQLAR
QGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDGKVLREGERLTLPRLADTYETLAIEGA
QAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDAVLYMPSAPLSGPV
LALILNILKGYNFSRASVETPEQKGLLYHRIVEAFRFAYAKRTLLGDPKAHPLCLSVVRN
MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYF
GSKVRSPVSGILFNDEMDDFSSPSITNQFGVPPSPANFIQPEGGCPGQAANQHPRLLPSA
TGKQPLSSMCPTIMVGQDGQVRMVVGASGGTQITTATALAIIYNLWFGYDVKRAVEEPRL
HNQLLPNVTTVERNIDQAVTAALETRHHDTEIASTFIAVVQAVVHTPGGWAAASDSRKGG
EPAGY
Download sequence
Identical sequences 9544.ENSMMUP00000027631 ENSMMUP00000027631 ENSMMUP00000037183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]