SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027637 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027637
Domain Number 1 Region: 9-140
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.51e-19
Family Gamma-glutamyltranspeptidase-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027637   Gene: ENSMMUG00000005980   Transcript: ENSMMUT00000029536
Sequence length 141
Comment pep:known_by_projection chromosome:MMUL_1:10:66168380:66169541:1 gene:ENSMMUG00000005980 transcript:ENSMMUT00000029536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGAWGHRTGMSPVSVLKEDSGAVVATSTINTLFGAMAYSLWTGIILNNEVLDLCEQCPRG
SGTTPSPVPGKCSPSFMVPSVLINKAQGSKLVIGGAGGELIISAVAQAIMNKLWLGFDLR
ATRILHVNSKGYVEYQSSFSQ
Download sequence
Identical sequences ENSMMUP00000027637 9544.ENSMMUP00000027637 ENSMMUP00000027637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]