SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027765 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027765
Domain Number 1 Region: 145-275
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-24
Family Cadherin 0.00015
Further Details:      
 
Domain Number 2 Region: 260-376
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-17
Family Cadherin 0.00038
Further Details:      
 
Domain Number 3 Region: 76-157
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000186
Family Cadherin 0.0014
Further Details:      
 
Domain Number 4 Region: 383-494
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000457
Family Cadherin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027765   Gene: ENSMMUG00000021094   Transcript: ENSMMUT00000029667
Sequence length 999
Comment pep:known chromosome:MMUL_1:18:24368872:24397763:1 gene:ENSMMUG00000021094 transcript:ENSMMUT00000029667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGLLPTTTGALAIFMVVILVHGELRIETKGQYDEEEMTVQQAKRRQKREWVKFAKPCRE
GEDNSKRNPIAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREET
PSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILN
ATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGA
DKDGEGLSTQCECSIKVKDVNDNFPMFRDSQYSARIEENTLSSELIRFQVTDLDEEYTDN
WLAVYFFTSGNEGNWFEIQTDPRTNEGILKVVKALDYEQLQSVKLSIAVKNKAEFHQSVI
SRYRVQSTPVTIQVINVREGIAFRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTGKAA
SNVRYVMGRNNGGYLMIDSKTAEIKFVKNMDRDSTFIVNQTITAEVLAIDEYTGRTSTGT
VYVRVPGFSDNCPTAVLDKDAICSSSPSVVVTTRTLNNRYTGPYTFALEDQPVKLPAIWS
ITTLNATSALLRAQEQIAPGVYHISLVLTDSQNNRCEMPGSLTLEVCQCDNRGVCGTSYP
TTWPGTRYGRPPSGRLGPAAIGLLLLGLLLLLLAPLLLLTCDCGAGSTGGVTGGFIPVPD
GSEGTIHQWGIEGAHPEDKEITNICVPPITANGADFMESSEVCTSTYARGTAVEGTSGME
MTTKLGAATESGGAAGFATGTVSAAASGFGAVTGVGICSSGQSGTMRTRHSTGGTNKDYT
DGAISMNFLDSYFSQKAFACAEEDDGQEANDCLLIYDNEGADATGSPVGSVGCCSFIADD
LDDSFLDSLGPKFKKLAEISLGVDGESKQVQPPSKDSGYGIESCGRSTEVQQSGFIKCQT
LSGGQGASALSASGSVQPAVSIPDPLQHGNYLVTETYSASGSLVQPSTAGFDPLLTQNVI
VTERVICPISSVPGNLAGPTQLRESHTMLCTEDPCSRLI
Download sequence
Identical sequences A0A2K5UXA4 F7GWF7
ENSMMUP00000027765 9544.ENSMMUP00000027765 ENSMMUP00000027765 XP_015295553.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]