SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027766 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027766
Domain Number 1 Region: 147-285
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-25
Family Cadherin 0.00029
Further Details:      
 
Domain Number 2 Region: 387-499
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000328
Family Cadherin 0.0076
Further Details:      
 
Domain Number 3 Region: 265-359
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000171
Family Cadherin 0.00058
Further Details:      
 
Domain Number 4 Region: 82-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000012
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 505-593
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000392
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027766   Gene: ENSMMUG00000021095   Transcript: ENSMMUT00000029668
Sequence length 1118
Comment pep:known_by_projection chromosome:MMUL_1:18:24419040:24468456:1 gene:ENSMMUG00000021095 transcript:ENSMMUT00000029668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSPGRAYALLLLLICFNVGSGLYLQVSSTRNENKLLPKHPHLVRQKRAWITAPVALRE
GEDLSKKNPIAKIHSDLTEERGLKVTYKYTGKGITEPPFGIFVFNKDTGELNITSILDRE
ETPFFLLTGYALDERGNNVEKPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMK
INATDADEPNTLNSKISYRIVSLEPAYPPVFYLNKDTGEIYTTSVTLDREEHSSYTLTVE
ARDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGMVEENQVNVEVTRIKVFDADE
IGSDNWLANFTFASGNEGGYFHIETDAQTNEGIVTLIKEVDYEEMKNLDFSVIVTNKAAF
HKSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISTYVSESMDKSSKGQIIGKFQAFDEDT
GLLARARYVKLEDRDNWISLDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKT
ITGTVLIYVEDINDNCPTLIEPVQTICNDAQYVNVTAEDLDGHPNSGPFSFSVIDKPPGM
AEKWKIVHQESTSVLLQQSEKKLGRSEIQFLISDNQGFSCPEKQMLTLTVCECLHGSGCR
EAQRDSYVGLGPAAIALMILAFLLLLLVPLLLLMCHCGKGGKGFTPIPGTIEMLHPWNNE
GAPPEDKVVPSFLPVDQGESLGGRNGVGGMAKEATMKGSSSASFAKGQHEMSEMDGRWEE
YRSLLSGRATQVTGATGAIMTTETTKTTRATGASRDMAGAQAAAVALNEEFLRNYFSDKA
ASYTEEDENHTAKDCLLVYSQEETESLNASIGCCSFIEGELDDRFLDDLGLKFKTLAEVC
LGQKIDINMEIEQRQKPATETSMNTASRSAYEQTMVNSENTYSSGSSFPVPKSLQEANAE
KVTQEIVTERSVSSRQAQKVATPLPDPVASRNIIATETSYVTGSTMPPSTVILGPRQPQS
LIVTERVYAPASALVDQPYANEGTVVVTERVIQPHGGGSNPLEGTQHLQDAPYVMVRERE
SFLAPSSGVQPTLAMPNITVGQNVTVTERVLAPASTLQSSYQIPTENSVKARNTMVSGAG
VPGPLPDFGLEESGHSNSTITTSSTRVTKHSTVQHSYS
Download sequence
Identical sequences A0A1D5Q0F3
9544.ENSMMUP00000027766 ENSMMUP00000027766 ENSMMUP00000027766 XP_001098597.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]