SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027965 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027965
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily SNARE-like 2.11e-27
Family Synatpobrevin N-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027965   Gene: ENSMMUG00000021237   Transcript: ENSMMUT00000029883
Sequence length 228
Comment pep:known chromosome:MMUL_1:2:93993248:94027922:1 gene:ENSMMUG00000021237 transcript:ENSMMUT00000029883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGRDFSI
HFSSFGDVACMAICSCQCPATMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDNIIQ
KVKWHFNYVSSSQMESSLEKIQEELKLQPPVVLTLEDTDVANGVMNGHIPMHLEPAPNFR
MEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQDPGSWFCWLDQTS
Download sequence
Identical sequences F7HTH5
ENSMMUP00000027965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]